New Monster High Scary Sweet Birthday Cleo De Nile Doll

Cleo De Nile fashion doll from the Monster High Scary Sweet Birthday collection dressed in a party outfit; includes a balloon, gift and 7 accessories. Doll cannot stand alone. Ages 4+.

Fashion doll with party-themed accessories (balloon, invite, birthday card, gift); golden cage skirt with beaded accents; sheer black sleeves with cascading ribbons; styling pieces such as black lipstick and a cake frosting purse. Includes 1 doll and 7 accessories. Doll cannot stand alone. Colors and decorations may vary.

Style

party

Occasion

party, birthday, gift

Gender

female

Age Group

kids

Condition

new

Category

Toys & Games > Toys > Dolls, Playsets & Toy Figures > Dolls

01high

A stylized fashion doll photographed on a white background. The doll has long dark-blue/teal hair with gold accessories, ornate gold-and-turquoise clothing with chain tassels and a snake motif, turquoise strappy platform sandals, and pronounced makeup. She holds a deep-green heart/bug-shaped balloon with gold details and a braided turquoise string in one hand and a gold shopping bag with a blue decorative print in the other.

fashion dollfemale dolltoylong straight blue hairgold jewelryheadpieceearringsnecklacemesh long sleevesblack dressgold ornate overlayturquoise/aqua fabricwhite ruffle trimgold chain tasselssnake motif accessory (turquoise)green heart/bug-shaped balloon with gold accentsturquoise braided balloon stringgold bow on balloongold shopping bag with blue decorative printturquoise strappy high-heel platform sandalstextured/wrapped right legmakeup (eyeshadow, lipstick)Egyptian-inspired stylingstudio white background

02high

Close-up image of a stylized fashion/toy doll with long metallic blue hair, Egyptian/serpent-inspired gold jewelry and ornate gold/teal dress details. The doll has bold eye makeup (blue and yellow eyes), black-and-gold lips, a black mesh sleeve with a tied ribbon, and is photographed against a white background.

fashion/toy dollfemale dollclose-up portraitwhite backgroundlong straight blue hair with metallic streaksblunt bangsgold snake/serpent-themed headpiecegold snake/serpent earringsgold necklace and shoulder adornmentsturquoise/teal dress fabricgold ornate filigree dress detailingturquoise snake/serpent accent on bodiceblack bodiceblack mesh sleeve with tied black ribbon/bowhand placed on hipstylized makeup (heavy eyeliner, decorated eyelashes)yellow and blue stylized eyesbold painted eyebrowsblack and gold painted lipsplastic vinyl material (toy surface)

03high

Close-up image of a fashion doll's midsection and partial face showing an ornate costume: a black bodice with a turquoise snake ornament, turquoise/fabric skirt panels overlaid with intricate gold filigree, white scalloped trim and hanging gold bead tassels. The doll wears gold jewelry and has dark blue hair; black sheer sleeves and a black-and-gold patterned underskirt are visible.

doll (torso and partial head)black strapless bodiceturquoise/aqua fabric skirt panelsgold filigree decorative overlayturquoise/blue snake-shaped ornament on bodicegold necklace with turquoise gemgold dangling earringsblack sheer/mesh long sleevesleft hand (doll)white scalloped trim near skirt hemgold bead/tassel strings hanging from skirtblack and gold patterned underskirtdark blue hair strandsgold lip accent/paint on lower lipgold rope/chain details on dress

04high

A child sits behind a white table playing with four fashion dolls arranged on stands. The scene is a colorful indoor studio set with magenta/purple ambient lighting, teal curtains, a pink sofa and neon wall lights (crescent moon, heart, bat). Several small doll accessories (mini purses, shoes) are placed on the table. Small disclaimer text appears along the image bottom.

OCR: DOLLS SOLD SEPARATELY. SUBJECT TO AVAILABILITY.

young girl (child) sitting and smilingfour fashion dolls on display (left to right: blue-themed doll, red/pink-haired doll, black/pink-haired doll, gold/teal-themed doll)white tabletopdoll stands/clear display pegssmall doll accessories on the table (mini purses/handbags, small accessories)sofa/couch with textured throwsdecorative cushions (pink, teal, purple)teal/green curtains in backgroundpurple/magenta ambient/studio lighting and wallsneon wall lights (crescent moon, heart, bat)props/scene set for toy play photographychild wearing a necklace and hair clipsmall printed disclaimer text at the bottom of the image